PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10028514
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 273aa    MW: 31040.4 Da    PI: 9.2124
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10028514genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.83.8e-16956148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W +eEd ll ++++ +G g+W++++++ g++R++k+c++rw++yl
      Lus10028514  9 RGTWGEEEDRLLRRCIHTYGEGRWHLVPARAGLNRCRKSCRLRWLNYL 56
                     89********************************************97 PP

2Myb_DNA-binding43.38.6e-1468106747
                      HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       E +ll++++k+lG++ W++Ia +++ gRt++++k++w+++
      Lus10028514  68 AEVDLLIRLHKLLGNR-WSLIAGRLP-GRTANDVKNYWNTH 106
                      5889************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.94460IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-20558IPR009057Homeodomain-like
SuperFamilySSF466894.49E-266103IPR009057Homeodomain-like
SMARTSM007174.7E-15858IPR001005SANT/Myb domain
PfamPF002496.7E-16956IPR001005SANT/Myb domain
CDDcd001672.97E-101156No hitNo description
Gene3DG3DSA:1.10.10.601.9E-2159109IPR009057Homeodomain-like
PROSITE profilePS5129416.57761111IPR017930Myb domain
SMARTSM007172.0E-1361109IPR001005SANT/Myb domain
PfamPF002492.5E-1263106IPR001005SANT/Myb domain
CDDcd001672.91E-969106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MELEAGLRRG TWGEEEDRLL RRCIHTYGEG RWHLVPARAG LNRCRKSCRL RWLNYLKPNI  60
KRGEFEGAEV DLLIRLHKLL GNRWSLIAGR LPGRTANDVK NYWNTHHREK EKKKLTTITT  120
SSSMPAAALT FPCKRQRHCT EPPVVIVEKG KITKTNIIRP RPVGLPKGFC WRAETNKQAQ  180
SRCVAAGDIN GGGSSTVWAQ ELKRFLEDDV DKFPAATCNK MTEHDNSSCS NDEIMKLGVE  240
GLTMFDRQEE GNHQSCWGDD DVSIWELLQR SS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-2071055102B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002534011.23e-62PREDICTED: transcription factor MYB113
SwissprotQ9FNV91e-55MY113_ARATH; Transcription factor MYB113
TrEMBLB9T6Z23e-62B9T6Z2_RICCO; R2r3-myb transcription factor, putative (Fragment)
STRINGSolyc10g086250.1.11e-58(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.17e-56myb domain protein 113